Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LRRC56 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17062620UL
Description
LRRC56 Polyclonal specifically detects LRRC56 in Human samples. It is validated for Western Blot.Specifications
LRRC56 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
leucine rich repeat containing 56 | |
Rabbit | |
Affinity Purified | |
RUO | |
115399 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LRRC56 | |
Synthetic peptides corresponding to LRRC56(leucine rich repeat containing 56) The peptide sequence was selected from the N terminal of LRRC56. Peptide sequence LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction