Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LSM6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15731820UL
Description
LSM6 Polyclonal specifically detects LSM6 in Human samples. It is validated for Western Blot.Specifications
LSM6 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P62312 | |
LSM6 | |
Synthetic peptides corresponding to LSM6(LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)) The peptide sequence was selected from the N terminal of LSM6. Peptide sequence MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), Sm protein F, U6 snRNA-associated Sm-like protein LSm6, YDR378C | |
Rabbit | |
Affinity Purified | |
RUO | |
11157 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction