Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LSM6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | LSM6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15731820
![]() |
Novus Biologicals
NBP15731820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157318
![]() |
Novus Biologicals
NBP157318 |
100 μL |
Each for $487.50
|
|
|||||
Description
LSM6 Polyclonal specifically detects LSM6 in Human samples. It is validated for Western Blot.Specifications
LSM6 | |
Polyclonal | |
Rabbit | |
P62312 | |
11157 | |
Synthetic peptides corresponding to LSM6(LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae)) The peptide sequence was selected from the N terminal of LSM6. Peptide sequence MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), Sm protein F, U6 snRNA-associated Sm-like protein LSm6, YDR378C | |
LSM6 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title