Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LSS Antibody, Novus Biologicals™
SDP

Catalog No. NBP15316620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15316620 20 μL
NBP153166 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15316620 Supplier Novus Biologicals Supplier No. NBP15316620UL

Rabbit Polyclonal Antibody

LSS Polyclonal specifically detects LSS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen LSS
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P48449
Gene Alias EC 5.4.99.7, FLJ350152,3-epoxysqualene--lanosterol cyclase, FLJ39450, FLJ46393, hOSC, human lanosterol synthase, EC 5.4.99.710EC 5.4.99, lanosterol synthase, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase, OSCFLJ25486, Oxidosqualene--lanosterol cyclase
Gene Symbols LSS
Host Species Rabbit
Immunogen Synthetic peptides corresponding to LSS(lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)) The peptide sequence was selected from the middle region of LSS. Peptide sequence KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4047
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.