LSS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233966

Catalog No. NBP233966

Description

LSS Polyclonal specifically detects LSS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LSS
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: P48449
• Gene Symbols: LSS
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 5.4.99.7, FLJ350152,3-epoxysqualene--lanosterol cyclase, FLJ39450, FLJ46393, hOSC, human lanosterol synthase, EC 5.4.99.710EC 5.4.99, lanosterol synthase, lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)2,3-epoxysqualene-lanosterol cyclase, OSCFLJ25486, Oxidosqualene--lanosterol cyclase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4047
• Target Species: Human
• Isotype: IgG

For Research Use Only