Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lunatic Fringe Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159432
Description
Lunatic Fringe Polyclonal specifically detects Lunatic Fringe in Human samples. It is validated for Western Blot.Specifications
Lunatic Fringe | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, lunatic fringe (Drosophila) homolog, lunatic fringe homolog (Drosophila), O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, SCDO3EC 2.4.1.222 | |
Rabbit | |
39 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Rabbit: 84%. | |
Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Yeast | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8NES3-3 | |
LFNG | |
Synthetic peptides corresponding to LFNG(LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) The peptide sequence was selected from the N terminal of LFNG. Peptide sequence LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK. | |
Affinity purified | |
RUO | |
3955 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction