Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lunatic Fringe Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Lunatic Fringe |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15943220
|
Novus Biologicals
NBP15943220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159432
|
Novus Biologicals
NBP159432 |
100 μL |
Each for $487.50
|
|
|||||
Description
Lunatic Fringe Polyclonal specifically detects Lunatic Fringe in Human samples. It is validated for Western Blot.Specifications
| Lunatic Fringe | |
| Polyclonal | |
| Rabbit | |
| Q8NES3-3 | |
| 3955 | |
| Synthetic peptides corresponding to LFNG(LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) The peptide sequence was selected from the N terminal of LFNG. Peptide sequence LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| beta-1,3-N-acetylglucosaminyltransferase lunatic fringe, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, lunatic fringe (Drosophila) homolog, lunatic fringe homolog (Drosophila), O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, SCDO3EC 2.4.1.222 | |
| LFNG | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title