Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lymphocyte Expansion Molecule Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17045420UL
Description
Lymphocyte Expansion Molecule Polyclonal specifically detects Lymphocyte Expansion Molecule in Human samples. It is validated for Western Blot.Specifications
C1orf177 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
chromosome 1 open reading frame 177 | |
Rabbit | |
47 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1ORF177 | |
Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN. | |
Affinity Purified | |
RUO | |
163747 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction