Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Lymphocyte Expansion Molecule Antibody, Novus Biologicals™

Lymphocyte Expansion Molecule Antibody, Novus Biologicals™
SDP

Catalog No. NBP17045420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17045420 20 μL
NBP170454 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17045420 Supplier Novus Biologicals Supplier No. NBP17045420UL

Description

Rabbit Polyclonal Antibody

Lymphocyte Expansion Molecule Polyclonal specifically detects Lymphocyte Expansion Molecule in Human samples. It is validated for Western Blot.

Specifications

Antigen C1orf177
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias chromosome 1 open reading frame 177
Gene Symbols C1ORF177
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN.
Molecular Weight of Antigen 47 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 163747
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.