Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lymphocyte Expansion Molecule Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | C1orf177 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17045420
![]() |
Novus Biologicals
NBP17045420UL |
20 μL |
Each for $206.00
|
|
|||||
NBP170454
![]() |
Novus Biologicals
NBP170454 |
100 μL |
Each for $487.50
|
|
|||||
Description
Lymphocyte Expansion Molecule Polyclonal specifically detects Lymphocyte Expansion Molecule in Human samples. It is validated for Western Blot.Specifications
C1orf177 | |
Polyclonal | |
Rabbit | |
chromosome 1 open reading frame 177 | |
C1ORF177 | |
IgG | |
47 kDa |
Western Blot | |
Unconjugated | |
RUO | |
163747 | |
Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title