Learn More
Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Antibody, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA0780FLJ25949, lysine (K)-specific demethylase 4C, lysine-specific demethylase 4C |
| Gene Symbols | KDM4C |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.