Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Lysosomal Pro-X Carboxypeptidase/PRCP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Lysosomal Pro-X Carboxypeptidase/PRCP Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB159796 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB159796 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. NB159796 Supplier Novus Biologicals Supplier No. NBP317883100UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Lysosomal Pro-X Carboxypeptidase/PRCP Polyclonal antibody specifically detects Lysosomal Pro-X Carboxypeptidase/PRCP in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen Lysosomal Pro-X Carboxypeptidase/PRCP
Applications Western Blot, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Angiotensinase C, EC 3.4.16.2, HUMPCP, Lysosomal carboxypeptidase C, lysosomal Pro-X carboxypeptidase, PCPMGC2202, Proline carboxypeptidase, Prolylcarboxypeptidase, prolylcarboxypeptidase (angiotensinase C), prolylcarboxypeptidase isoform 1 preproprotein
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 5547
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.