Lysyl Oxidase Homolog 2/LOXL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174065

Catalog No. NBP174065

Description

Lysyl Oxidase Homolog 2/LOXL2 Polyclonal specifically detects Lysyl Oxidase Homolog 2/LOXL2 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Lysyl Oxidase Homolog 2/LOXL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
• Host Species: Rabbit
• Molecular Weight of Antigen: 85 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 83% Xenopus: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P58022
• Gene Symbols: LOXL2
• Immunogen: Synthetic peptides corresponding to the C terminal of Loxl2. Immunizing peptide sequence NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4017
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.