Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Lysyl Oxidase Homolog 2/LOXL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Lysyl Oxidase Homolog 2/LOXL2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17406520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17406520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174065 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174065	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Lysyl Oxidase Homolog 2/LOXL2 Polyclonal specifically detects Lysyl Oxidase Homolog 2/LOXL2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	Lysyl Oxidase Homolog 2/LOXL2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P58022
Gene ID (Entrez)	4017
Immunogen	Synthetic peptides corresponding to the C terminal of Loxl2. Immunizing peptide sequence NNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
Gene Symbols	LOXL2
Isotype	IgG
Molecular Weight of Antigen	85 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Lysyl Oxidase Homolog 2/LOXL2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents