Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lysyl Oxidase Homolog 3/LOXL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17980320UL
Description
Lysyl Oxidase Homolog 3/LOXL3 Polyclonal specifically detects Lysyl Oxidase Homolog 3/LOXL3 in Human samples. It is validated for Western Blot.Specifications
| Lysyl Oxidase Homolog 3/LOXL3 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_115992 | |
| LOXL3 | |
| Synthetic peptide directed towards the middle region of human LOXL3The immunogen for this antibody is LOXL3. Peptide sequence AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 1.4.3, EC 1.4.3.-, EC 1.4.3.13, LOXL, lysyl oxidase homolog 3, lysyl oxidase-like 3, Lysyl oxidase-like protein 3 | |
| Rabbit | |
| 80 kDa | |
| 20 μL | |
| Lipid and Metabolism | |
| 84695 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction