Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lysyl Oxidase Homolog 3/LOXL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$541.95
Specifications
| Antigen | Lysyl Oxidase Homolog 3/LOXL3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179803
|
Novus Biologicals
NBP179803 |
100 μL |
Each for $541.95
|
|
|||||
|
NBP17980320
|
Novus Biologicals
NBP17980320UL |
20 μL | N/A | N/A | N/A | ||||
Description
Lysyl Oxidase Homolog 3/LOXL3 Polyclonal specifically detects Lysyl Oxidase Homolog 3/LOXL3 in Human samples. It is validated for Western Blot.Specifications
| Lysyl Oxidase Homolog 3/LOXL3 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| EC 1.4.3, EC 1.4.3.-, EC 1.4.3.13, LOXL, lysyl oxidase homolog 3, lysyl oxidase-like 3, Lysyl oxidase-like protein 3 | |
| LOXL3 | |
| IgG | |
| 80 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_115992 | |
| 84695 | |
| Synthetic peptide directed towards the middle region of human LOXL3The immunogen for this antibody is LOXL3. Peptide sequence AASSGQKKQQQSKPQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title