Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LYVE-1 Antibody, Novus Biologicals™
SDP

Catalog No. NB396798 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396798 25 μL
NBP238500 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396798 Supplier Novus Biologicals Supplier No. NBP23850025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

LYVE-1 Polyclonal specifically detects LYVE-1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen LYVE-1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9Y5Y7
Gene Alias cell surface retention sequence binding protein-1, Cell surface retention sequence-binding protein 1, CRSBP1, CRSBP-1, extracellular link domain containing 1, extracellular link domain-containing 1, Extracellular link domain-containing protein 1, HAR, Hyaluronic acid receptor, lymphatic vessel endothelial hyaluronan receptor 1, lymphatic vessel endothelial hyaluronic acid receptor 1, LYVE-1XLKD1
Gene Symbols LYVE1
Host Species Rabbit
Immunogen This LYVE-1 Antibody was developed against a recombinant protein corresponding to amino acids: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA
Molecular Weight of Antigen 35 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Cardiovascular Biology, Endosome Markers, Endothelial Cell Markers, Immunology, Inflammation, Metastasis
Primary or Secondary Primary
Gene ID (Entrez) 10894
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.