LZTR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255068

Catalog No. NBP255068

Description

LZTR2 Polyclonal specifically detects LZTR2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: LZTR2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp686C2486, FLJ23871, FLJ25761, KIAA1928, Leucine zipper transcription regulator 2FLJ36620, LZTR2SEC16Sprotein SEC16 homolog B, PGPR-p117, protein transport protein Sec16B, Regucalcin gene promoter region-related protein p117, regucalcin gene promotor region related protein, RGPRFLJ33652, RGPR-p117, SEC16 homolog B, SEC16 homolog B (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 89866
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SEC16B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHEDYREQKYLDEHHYENQHSPFGTNSETHFQSNSR
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only