Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MACC1 Antibody (CL0856), Novus Biologicals™

MACC1 Antibody (CL0856), Novus Biologicals™
SDP

Catalog No. NB395333 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395333 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395333 Supplier Novus Biologicals Supplier No. NBP25295525UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

MACC1 Monoclonal antibody specifically detects MACC1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen MACC1
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0856
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias metastasis associated in colon cancer 1, SH3 domain-containing protein 7a5,7A5
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 346389
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.