Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MafA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | MafA |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
MafA Polyclonal specifically detects MafA in Human samples. It is validated for Western Blot.Specifications
| MafA | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Diabetes Research, Lipid and Metabolism, Transcription Factors and Regulators | |
| PBS buffer, 2% sucrose | |
| 389692 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| hMafA, Pancreatic beta-cell-specific transcriptional activator, RIPE3B1, transcription factor MafA, Transcription factor RIPE3b1, V-maf musculoaponeurotic fibrosarcoma oncogene homolog A, v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian) | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human MafA (NP_963883). Peptide sequence PSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title