Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MafB Antibody, Novus Biologicals™
SDP

Catalog No. NB035391 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB035391 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB035391 Supplier Novus Biologicals Supplier No. NBP287769
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MafB Polyclonal specifically detects MafB in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen MafB
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose
Gene Alias Kreisler (mouse) maf-related leucine zipper homolog, Kreisler maf-related leucine zipper homolog, KRMLMAFB/Kreisler basic region/leucine zipper transcription factor, Maf-B, MGC43127, transcription factor MafB, V-maf musculoaponeurotic fibrosarcoma oncogene homolog B, v-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MafB. Peptide Sequence LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Diabetes Research, Lipid and Metabolism, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 9935
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.