MafK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179223

Catalog No. NBP179223

Description

MafK Polyclonal specifically detects MafK in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: MafK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ32205, MGC71717, transcription factor MafK, ubiquitous (p18), v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_034887
• Gene Symbols: MAFK
• Immunogen: The immunogen for this antibody is Mafk. Peptide sequence TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR.
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing, Epigenetics
• Gene ID (Entrez): 7975
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.