Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MafK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MafK |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MafK Polyclonal specifically detects MafK in Mouse samples. It is validated for Western Blot.Specifications
MafK | |
Polyclonal | |
Rabbit | |
NP_034887 | |
7975 | |
The immunogen for this antibody is Mafk. Peptide sequence TTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ32205, MGC71717, transcription factor MafK, ubiquitous (p18), v-maf avian musculoaponeurotic fibrosarcoma oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma (avian) oncogene family, protein K, v-maf musculoaponeurotic fibrosarcoma oncogene homolog K (avian) | |
MAFK | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title