Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAGEA11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169034
Description
MAGEA11 Polyclonal specifically detects MAGEA11 in Human samples. It is validated for Western Blot.Specifications
MAGEA11 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
MAGEA11 | |
Synthetic peptides corresponding to MAGEA11 (melanoma antigen family A, 11) The peptide sequence was selected from the middle region of MAGEA11. Peptide sequence FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ. | |
Affinity purified | |
RUO | |
4110 | |
Human, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Cancer/testis antigen 1.11, CT1.11MAGE-11 antigen, MAGE11member 11, MAGEA-11, melanoma antigen family A, 11, melanoma-associated antigen 11, MGC10511 | |
Rabbit | |
48 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction