Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MAGEA11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | MAGEA11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
MAGEA11 Polyclonal specifically detects MAGEA11 in Human samples. It is validated for Western Blot.Specifications
MAGEA11 | |
Polyclonal | |
Rabbit | |
Cancer/testis antigen 1.11, CT1.11MAGE-11 antigen, MAGE11member 11, MAGEA-11, melanoma antigen family A, 11, melanoma-associated antigen 11, MGC10511 | |
MAGEA11 | |
IgG | |
48 kDa |
Western Blot | |
Unconjugated | |
RUO | |
4110 | |
Synthetic peptides corresponding to MAGEA11 (melanoma antigen family A, 11) The peptide sequence was selected from the middle region of MAGEA11. Peptide sequence FSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title