MAGI1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258071

Catalog No. NBP258071

Description

MAGI1 Polyclonal specifically detects MAGI1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MAGI1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AIP-3, AIP3WW and PDZ domain-containing protein 1, membrane associated guanylate kinase, WW and PDZ domain containing 1, TNRC19BAP-1, WWP3WW domain-containing protein 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAGI1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 9223
• Target Species: Human
• Isotype: IgG

For Research Use Only