Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MAP1S Antibody, Novus Biologicals™

MAP1S Antibody, Novus Biologicals™
SDP

Catalog No. NB395902 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395902 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395902 Supplier Novus Biologicals Supplier No. NBP24898725UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MAP1S Polyclonal antibody specifically detects MAP1S in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen MAP1S
Applications Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias BPY2 interacting protein 1, BPY2IP1VCY2IP-1, C19orf5, chromosome 19 open reading frame 5, FLJ10669, MAP8MAP-1S, MGC133087, microtubule-associated protein 1S, Microtubule-associated protein 8, Variable charge Y chromosome 2-interacting protein 1, VCY2 interacting protein 1, VCY2-interacting protein 1, VCY2IP1BPY2-interacting protein 1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55201
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.