Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAP2 Antibody (CL5420), Novus Biologicals™
SDP

Catalog No. NBP261417 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP261417 100 μL
NB403033 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP261417 Supplier Novus Biologicals Supplier No. NBP261417
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

MAP2 Monoclonal specifically detects MAP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Single Cell Western.

Specifications

Antigen MAP2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL5420
Concentration 1 mg/mL
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 2-10 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Single Cell Western 100 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias DKFZp686I2148, MAP-2, MAP2A, MAP2B, MAP2C, Microtubule Associated Protein 2, microtubule-associated protein 2, MTAP2
Gene Symbols MAP2
Host Species Mouse
Immunogen MAP2 Antibody (CL5420) was developed against a human recombinant protein corresponding to amino acids: EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Molecular Weight of Antigen 199 kDa
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Cellular Markers, Cytoskeleton Markers, MAP Kinase Signaling, Neuronal Stem Cells, Neuroscience, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4133
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.