Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MAP3K12 Antibody, Novus Biologicals™
SDP

Catalog No. NB393668 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393668 25 μL
NBP258000 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393668 Supplier Novus Biologicals Supplier No. NBP25800025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

MAP3K12 Polyclonal specifically detects MAP3K12 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen MAP3K12
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias DLKEC 2.7.11.25, Dual leucine zipper bearing kinase, EC 2.7.11, Leucine-zipper protein kinase, MAPK-upstream kinase, MEKK12, mitogen-activated protein kinase kinase kinase 12, Mixed lineage kinase, MUKdual leucine zipper kinase DLK, protein kinase MUK, ZPKleucine zipper protein kinase, ZPKP1
Gene Symbols MAP3K12
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 7786
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.