Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MAP3K15 Antibody, Novus Biologicals™

MAP3K15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP152971 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP152971 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP152971 Supplier Novus Biologicals Supplier No. NBP152971
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MAP3K15 Polyclonal specifically detects MAP3K15 in Human samples. It is validated for Western Blot.

Specifications

Antigen MAP3K15
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6ZN16-3
Gene Alias Apoptosis signal-regulating kinase 3, ASK3MEKK 15, bA723P2.3, EC 2.7.11, EC 2.7.11.25, FLJ16518, MAPK/ERK kinase kinase 15, MEK kinase 15, mitogen-activated protein kinase kinase kinase 15
Gene Symbols MAP3K15
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MAP3K15. Peptide Sequence YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 389840
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.