MAP3K15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152971

Catalog No. NBP152971

Description

MAP3K15 Polyclonal specifically detects MAP3K15 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MAP3K15
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Apoptosis signal-regulating kinase 3, ASK3MEKK 15, bA723P2.3, EC 2.7.11, EC 2.7.11.25, FLJ16518, MAPK/ERK kinase kinase 15, MEK kinase 15, mitogen-activated protein kinase kinase kinase 15
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ZN16-3
• Gene Symbols: MAP3K15
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAP3K15. Peptide Sequence YQNLLRQTLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRL. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 389840
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.