MAPKAPK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25719725UL

Catalog No. NB394082

Description

MAPKAPK2 Polyclonal specifically detects MAPKAPK2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MAPKAPK2
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: EC 2.7.11, EC 2.7.11.1, MAP kinase-activated protein kinase 2, MAPK-activated protein kinase 2, MAPKAP kinase 2, MAPKAPK-2, mitogen-activated protein kinase-activated protein kinase 2, MK2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MAPKAPK2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cancer, MAP Kinase Signaling, Protein Kinase, Signal Transduction
• Gene ID (Entrez): 9261
• Target Species: Human
• Form: Purified

For Research Use Only