Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16005120UL
Description
44257 Polyclonal specifically detects 44257 in Human samples. It is validated for Western Blot.Specifications
| MARCH2 | |
| Polyclonal | |
| Western Blot 0.2-1 ug/ml | |
| Q9P0N8 | |
| 43161 | |
| Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| EC 6.3.2, EC 6.3.2.-, MARCH-IIHSPC240, membrane-associated ring finger (C3HC4) 2, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, RING finger protein 172, RNF172E3 ubiquitin-protein ligase MARCH2 | |
| Rabbit | |
| 27 kDa | |
| 20 μL | |
| Zinc Finger | |
| 51257 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction