Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MARCH2 Antibody, Novus Biologicals™

MARCH2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1600520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1600520 20 μL
NBP160051 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1600520 Supplier Novus Biologicals Supplier No. NBP16005120UL

Description

Rabbit Polyclonal Antibody

44257 Polyclonal specifically detects 44257 in Human samples. It is validated for Western Blot.

Specifications

Antigen MARCH2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9P0N8
Gene Alias EC 6.3.2, EC 6.3.2.-, MARCH-IIHSPC240, membrane-associated ring finger (C3HC4) 2, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, RING finger protein 172, RNF172E3 ubiquitin-protein ligase MARCH2
Gene Symbols 43161
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV.
Molecular Weight of Antigen 27 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 51257
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.