Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MARCH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | MARCH2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1600520
|
Novus Biologicals
NBP16005120UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP160051
|
Novus Biologicals
NBP160051 |
100 μL |
Each for $487.50
|
|
|||||
Description
44257 Polyclonal specifically detects 44257 in Human samples. It is validated for Western Blot.Specifications
| MARCH2 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| EC 6.3.2, EC 6.3.2.-, MARCH-IIHSPC240, membrane-associated ring finger (C3HC4) 2, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, RING finger protein 172, RNF172E3 ubiquitin-protein ligase MARCH2 | |
| 43161 | |
| IgG | |
| 27 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9P0N8 | |
| 51257 | |
| Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title