Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$158.00 - $487.50

Specifications

Antigen MARCH2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1600520
SDP
View Documents
Novus Biologicals
NBP16005120UL
20 μL
Each for $158.00
Only null left
Add to Cart
 
NBP160051
SDP
View Documents
Novus Biologicals
NBP160051
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

44257 Polyclonal specifically detects 44257 in Human samples. It is validated for Western Blot.
Specifications

Specifications

MARCH2
Polyclonal
Rabbit
Zinc Finger
EC 6.3.2, EC 6.3.2.-, MARCH-IIHSPC240, membrane-associated ring finger (C3HC4) 2, Membrane-associated RING finger protein 2, Membrane-associated RING-CH protein II, RING finger protein 172, RNF172E3 ubiquitin-protein ligase MARCH2
43161
IgG
27 kDa
Western Blot
Unconjugated
RUO
Q9P0N8
51257
Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV.
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.