Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MARCH3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17419420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17419420 20 μL
NBP174194 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17419420 Supplier Novus Biologicals Supplier No. NBP17419420UL

Rabbit Polyclonal Antibody

44258 Polyclonal specifically detects 44258 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen MARCH3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q8BRX9
Gene Alias EC 6.3.2, EC 6.3.2.-, MARCH-IIIFLJ20096, membrane-associated ring finger (C3HC4) 3, Membrane-associated RING finger protein 3, Membrane-associated RING-CH protein III, MGC48332, RING finger protein 173, RNF173E3 ubiquitin-protein ligase MARCH3
Gene Symbols 43162
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the C terminal of March3. Immunizing peptide sequence PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 115123
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.