MARCKS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258267

Catalog No. NBP258267

Description

MARCKS Polyclonal specifically detects MARCKS in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: MARCKS
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 80K-L, 80K-L protein, FLJ14368, MACSmyristoylated alanine-rich C-kinase substrate, MRACKS, myristoylated alanine-rich protein kinase C substrate, myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L), phosphomyristin, PKCSLFLJ90045, PRKCSL, Protein kinase C substrate, 80 kDa protein, light chain
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: MARCKS
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 4082
• Target Species: Human
• Isotype: IgG

For Research Use Only