Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    MARCO Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15954320UL
Description
MARCO Polyclonal specifically detects MARCO in Human samples. It is validated for Western Blot.Specifications
| MARCO | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9UEW3 | |
| MARCO | |
| Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG | 
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8685 | |
| Store at -20C. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction