Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MARCO Antibody, Novus Biologicals™

MARCO Antibody, Novus Biologicals™
SDP

Catalog No. NBP15954320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15954320 20 μL
NBP159543 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15954320 Supplier Novus Biologicals Supplier No. NBP15954320UL

Description

Rabbit Polyclonal Antibody

MARCO Polyclonal specifically detects MARCO in Human samples. It is validated for Western Blot.

Specifications

Antigen MARCO
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9UEW3
Gene Alias macrophage receptor with collagenous structureSCARA2Scavenger receptor class A member 2, member 2
Gene Symbols MARCO
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MARCO(macrophage receptor with collagenous structure) The peptide sequence was selected from the N terminal of MARCO. Peptide sequence QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8685
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.