MASA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155361

Catalog No. NBP155361

Description

MASA Polyclonal specifically detects MASA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MASA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: acireductone synthase, DKFZp586M0524, E1, EC 3.1.3.77, enolase-phosphatase 1, enolase-phosphatase E1, MASA homolog, MASAFLJ12594, MST1452,3-diketo-5-methylthio-1-phosphopentane phosphatase
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 58478
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UHY7
• Gene Symbols: ENOPH1
• Immunogen: Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Equine: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG