Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MASA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15536120UL
Description
MASA Polyclonal specifically detects MASA in Human samples. It is validated for Western Blot.Specifications
| MASA | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9UHY7 | |
| ENOPH1 | |
| Synthetic peptides corresponding to ENOPH1(enolase-phosphatase 1) Antibody(against the N terminal of ENOPH1. Peptide sequence IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| acireductone synthase, DKFZp586M0524, E1, EC 3.1.3.77, enolase-phosphatase 1, enolase-phosphatase E1, MASA homolog, MASAFLJ12594, MST1452,3-diketo-5-methylthio-1-phosphopentane phosphatase | |
| Rabbit | |
| 29 kDa | |
| 20 μL | |
| Stem Cell Markers | |
| 58478 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction