Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MAVS Antibody, Novus Biologicals™

MAVS Antibody, Novus Biologicals™
SDP

Catalog No. NB436158 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436158 25 μL
NBP238613 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436158 Supplier Novus Biologicals Supplier No. NBP23861325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

MAVS Polyclonal specifically detects MAVS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen MAVS
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q7Z434
Gene Alias CARD adapter inducing interferon beta, CARD adapter inducing interferon-beta, CARD adaptor inducing IFN-beta, CARDIF, DKFZp547C224, DKFZp666M015, FLJ27482, IFN-B promoter stimulator 1, Interferon beta promoter stimulator protein 1, interferon-beta promoter stimulator protein 1, IPS-1FLJ41962, IPS1MGC3260, KIAA1271FLJ35386, mitochondrial antiviral signaling protein, mitochondrial antiviral-signaling protein, mitochondrial viral signaling protein, Putative NF-kappa-B-activating protein 031N, virus-induced signaling adapter variant 1b, virus-induced signaling adaptor variant 1a, Virus-induced-signaling adapter, VISAFLJ38051
Gene Symbols MAVS
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKV
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immune Dysfunction, Immune System Diseases, Immunology, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 57506
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.