Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MB21D2 Antibody, Novus Biologicals™

MB21D2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17952720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17952720 20 μL
NBP179527 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17952720 Supplier Novus Biologicals Supplier No. NBP17952720UL

Description

Rabbit Polyclonal Antibody

MB21D2 Polyclonal specifically detects MB21D2 in Human samples. It is validated for Western Blot.

Specifications

Antigen MB21D2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_848591
Gene Alias C3orf59, chromosome 3 open reading frame 59, hypothetical protein LOC151963, Mab-21 domain containing 2, Mab-21 domain-containing protein 2
Gene Symbols MB21D2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human C3orf59. Peptide sequence QSDGGDPNQPDDRLAKKLQQLVTENPGKSISVFINPDDVTRPHFRIDDKF.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 151963
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.