MBOAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155258

Catalog No. NBP155258

Description

MBOAT1 Polyclonal specifically detects MBOAT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MBOAT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ZNC8
• Gene Symbols: MBOAT1
• Immunogen: Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 154141
• Target Species: Human, Mouse, Rat, Pig, Equine, Rabbit
• Isotype: IgG