MBOAT7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162511

Catalog No. NBP162511

Description

MBOAT7 Polyclonal specifically detects MBOAT7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: MBOAT7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 1-acylglycerophosphatidylinositol O-acyltransferase, BB1LPLAT 7, Bladder and breast carcinoma-overexpressed gene 1 protein, EC 2.3.1.-, EC 2.3.1.n4, h-mboa-7, hMBOA-7, LENG4FLJ41296, leukocyte receptor cluster (LRC) member 4, Leukocyte receptor cluster member 4, LPIATO-acyltransferase domain-containing protein 7, LRC4, Lysophosphatidylinositol acyltransferase, lysophospholipid acyltransferase 7, Lyso-PI acyltransferase, malignant cell expression-enhanced gene/tumor progression-enhanced, MBOA7, membrane bound O-acyltransferase domain containing 7, Membrane-bound O-acyltransferase domain-containing protein 7, OACT7
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96N66
• Gene Symbols: MBOAT7
• Immunogen: Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4 (NM_024298). Peptide sequence WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79143
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only