Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB344509

MBP Antibody (7D2), Allophycocyanin, Novus Biologicals™
SDP

Catalog No. NB344509 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB344509 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB344509 Supplier Novus Biologicals Supplier No. NBP105204APC
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen MBP
Applications Western Blot, Immunohistochemistry, Immunocytochemistry
Classification Monoclonal
Clone 7D2
Conjugate APC
Dilution Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence
Formulation PBS
Gene Alias MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
Host Species Mouse
Immunogen Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Phospho Specific, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 4155
Target Species Human, Mouse, Rat, Pig, Bovine
Content And Storage Store at 4C in the dark.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.