Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MBP Antibody (7D2), PE, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP105204PE
Description
MBP Monoclonal antibody specifically detects MBP in Human, Mouse, Rat, Porcine, Bovine, Equine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ ImmunofluorescenceSpecifications
| MBP | |
| Monoclonal | |
| PE | |
| PBS | |
| Mouse | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat, Pig, Bovine | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry | |
| 7D2 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence | |
| MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein | |
| Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence. | |
| 0.1 mL | |
| Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Phospho Specific, Stem Cell Markers | |
| 4155 | |
| Store at 4C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction