MCCC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324973

Catalog No. NB301479

Description

MCCC1 Polyclonal antibody specifically detects MCCC1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: MCCC1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: 3-methylcrotonyl-CoA carboxylase 1, DKFZp686B20267, EC 6.4.1, EC 6.4.1.4, MCCAFLJ25545, MCC-B, methylcrotonoyl-CoA carboxylase 1 (alpha), methylcrotonoyl-Coenzyme A carboxylase 1 (alpha), mitochondrial
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein MCCC1 using the following amino acid sequence: LLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTF
• Quantity: 100 μL
• Research Discipline: Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
• Gene ID (Entrez): 56922
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified