Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
MCG10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255526
Description
MCG10 Polyclonal specifically detects MCG10 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
MCG10 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
alpha-CP4, alphaCP-4 protein, CBP, LIP4, LYST-interacting protein, MCG10, poly(rC) binding protein 4, poly(rC)-binding protein 4, RNA binding protein MCG10 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PCBP4 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP | |
100 μL | |
Apoptosis, Autophagy, Cancer, DNA Repair, Embryonic Stem Cell Markers, Stem Cell Markers | |
57060 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction