MCM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233954

Catalog No. NBP233954

Description

MCM2 Polyclonal specifically detects MCM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: MCM2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P49736
• Gene Symbols: MCM2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQD
• Quantity: 0.1 mL
• Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers
• Gene ID (Entrez): 4171
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BM28MGC10606, CCNL 1, CCNL1, CDCL1mitotin, EC 3.6.4.12, KIAA0030MITOTIN, MCM2 minichromosome maintenance deficient 2, mitotin (S. cerevisiae), minichromosome maintenance complex component 2, minichromosome maintenance deficient (S. cerevisiae) 2 (mitotin), minichromosome maintenance deficient 2 (mitotin)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only