MCM4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25837025UL

Catalog No. NB393485

Description

MCM4 Polyclonal specifically detects MCM4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

• Antigen: MCM4
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CDC21, CDC21 homolog, CDC54, DNA replication licensing factor MCM4, EC 3.6.4.12, hCdc21, homolog of S. pombe cell devision cycle 21, MCM4 minichromosome maintenance deficient 4, MCM4 minichromosome maintenance deficient 4 (S. cerevisiae), MGC33310, minichromosome maintenance complex component 4, minichromosome maintenance deficient 4, P1-Cdc21
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: MCM4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSPPQMHSSAIPLDFDVSSPLTYGTPSSRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSLGQKLVIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVG
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Stem Cell Markers
• Gene ID (Entrez): 4173
• Target Species: Human
• Isotype: IgG

For Research Use Only