Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MCM8 Antibody, Novus Biologicals™

MCM8 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15813020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15813020 20 μL
NBP158130 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15813020 Supplier Novus Biologicals Supplier No. NBP15813020UL

Description

Rabbit Polyclonal Antibody

MCM8 Polyclonal specifically detects MCM8 in Human samples. It is validated for Western Blot.

Specifications

Antigen MCM8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.125 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UJA3
Gene Alias C20orf154, chromosome 20 open reading frame 154, dJ967N21.5, DNA replication licensing factor MCM8, MCM8 minichromosome maintenance deficient 8, MGC119522, MGC119523, MGC12866, MGC4816, Minichromosome maintenance 8, minichromosome maintenance complex component 8, REC, REC homolog
Gene Symbols MCM8
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MCM8 (minichromosome maintenance complex component 8) The peptide sequence was selected from the N terminal of MCM8. Peptide sequence ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH.
Molecular Weight of Antigen 92 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 84515
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.