Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

MCM9 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1582820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1582820 20 μL
NBP158128 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1582820 Supplier Novus Biologicals Supplier No. NBP15812820UL

Rabbit Polyclonal Antibody

MCM9 Polyclonal specifically detects MCM9 in Human samples. It is validated for Western Blot.

Specifications

Antigen MCM9
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. B3KV41
Gene Alias C6orf61, chromosome 6 open reading frame 61, dJ329L24.1, dJ329L24.3, DNA replication licensing factor MCM9, FLJ13942, FLJ20170, FLJ56845, hMCM9, MCMDC1, MGC35304, minichromosome maintenance complex component 9, Mini-chromosome maintenance deficient 9, minichromosome maintenance deficient domain containing 1, Mini-chromosome maintenance deficient domain-containing protein 1
Gene Symbols MCM9
Host Species Rabbit
Immunogen Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of human MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN.
Molecular Weight of Antigen 44 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 254394
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.