Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MCT1/SLC16A1 Antibody, Novus Biologicals™

MCT1/SLC16A1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15987920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15987920 20 μL
NBP159879 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15987920 Supplier Novus Biologicals Supplier No. NBP15987920UL

Description

Rabbit Polyclonal Antibody

MCT1/SLC16A1 Polyclonal specifically detects MCT1/SLC16A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen MCT1/SLC16A1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P53985
Gene Alias FLJ36745, HHF7, MCT, MCT 1, MCT1MGC44475, member 1, monocarboxylate transporter 1, Solute carrier family 16 member 1, solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Gene Symbols SLC16A1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC16A1(solute carrier family 16, member 1 (monocarboxylic acid transporter 1)) The peptide sequence was selected from the middle region of SLC16A1. Peptide sequence EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQ
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6566
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.